Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MRPL24 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MRPL24 Polyclonal specifically detects MRPL24 in Human samples. It is validated for Western Blot.Specifications
MRPL24 | |
Polyclonal | |
Rabbit | |
Q96A35 | |
79590 | |
Synthetic peptides corresponding to MRPL24(mitochondrial ribosomal protein L24) The peptide sequence was selected from the N terminal of MRPL24. Peptide sequence RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ20917, L24mt, MGC22737, MGC9831, mitochondrial, mitochondrial ribosomal protein L24, MRP-L18, MRP-L24 | |
MRPL24 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title