Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MRPL3 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MRPL3 Polyclonal specifically detects MRPL3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MRPL3 | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
11222 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Human | |
39S ribosomal protein L3, mitochondrial, mitochondrial ribosomal protein L3, MRL3mitochondrial, L3, RPML3 | |
MRPL3 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title