Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MRPL44 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	MRPL44
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP238394 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238394	0.1 mL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB436224 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23839425UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

MRPL44 Polyclonal specifically detects MRPL44 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	MRPL44
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q9H9J2
Gene ID (Entrez)	65080
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: SGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQ
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	39S ribosomal protein L44, mitochondrial, EC 3.1.26, EC 3.1.26.-, FLJ12701, FLJ13990, FLJ37688, L44MT, mitochondrial ribosomal protein L44, MRP-L44
Gene Symbols	MRPL44
Isotype	IgG
Purification Method	Affinity Purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MRPL44 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents