MRPL49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21361825UL

Catalog No. NB438403

Description

MRPL49 Polyclonal specifically detects MRPL49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRPL49
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C11orf4, L49mt39S ribosomal protein L49, mitochondrial, mitochondrial ribosomal protein L49, MRP-L49, Neighbor of FAU, next to FAU, NOF1chromosome 11 open reading frame 4, NOFMGC10656, Protein NOF1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MRPL49
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
• Quantity: 25ul
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 740
• Target Species: Human
• Isotype: IgG

For Research Use Only