Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRPS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MRPS2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MRPS2 Polyclonal specifically detects MRPS2 in Human samples. It is validated for Western Blot.Specifications
MRPS2 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
Q9Y399 | |
51116 | |
Synthetic peptides corresponding to MRPS2(mitochondrial ribosomal protein S2) The peptide sequence was selected from the N terminal of MRPS2. Peptide sequence MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
28S ribosomal protein S2, mitochondrial, CGI-91, mitochondrial 28S ribosomal protein S2, mitochondrial ribosomal protein S2, MRP-S2, S2mt | |
MRPS2 | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title