Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MRS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MRS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15961420
|
Novus Biologicals
NBP15961420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159614
|
Novus Biologicals
NBP159614 |
100 μL |
Each for $487.50
|
|
|||||
Description
MRS2 Polyclonal specifically detects MRS2 in Human samples. It is validated for Western Blot.Specifications
| MRS2 | |
| Polyclonal | |
| Rabbit | |
| Q9HD23 | |
| 57380 | |
| Synthetic peptides corresponding to MRS2L The peptide sequence was selected from the middle region of MRS2L. Peptide sequence LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HPT, MGC78523, mitochondrial, MRS2 magnesium homeostasis factor homolog (S. cerevisiae), MRS2-like protein, MRS2-like, magnesium homeostasis factor, MRS2-like, magnesium homeostasis factor (S. cerevisiae) | |
| MRS2 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title