MRTO4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188334

Catalog No. NBP188334

Description

MRTO4 Polyclonal specifically detects MRTO4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRTO4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: C1orf33, chromosome 1 open reading frame 33, dJ657E11.4, mRNA turnover 4 homolog (S. cerevisiae), mRNA turnover protein 4 homolog, MRT4, mRNA turnover 4, homolog, MRT4, mRNA turnover 4, homolog (S. cerevisiae), MRT460S acidic ribosomal protein PO
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MRTO4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51154
• Target Species: Human
• Isotype: IgG

For Research Use Only