Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MRTO4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153203

 View more versions of this product

Catalog No. NBP153203

Add to cart



MRTO4 Polyclonal antibody specifically detects MRTO4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to MRTO4(mRNA turnover 4 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MRTO4. Peptide sequence SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV.
27 kDa
Core ESC Like Genes, Stem Cell Markers
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
C1orf33, chromosome 1 open reading frame 33, dJ657E11.4, mRNA turnover 4 homolog (S. cerevisiae), mRNA turnover protein 4 homolog, MRT4, mRNA turnover 4, homolog, MRT4, mRNA turnover 4, homolog (S. cerevisiae), MRT460S acidic ribosomal protein PO
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Zebrafish: 77%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit