MS4A1 Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-934-586	100 μL

Catalog No. 89-934-586 Supplier Abnova Corporation Supplier No. PAB29580

Description

Rabbit polyclonal antibody raised against partial recombinant human MS4A1.

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq]

Sequence: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY

Specifications

• Antigen: MS4A1
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against partial recombinant human MS4A1.
• Dilution: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: B1/Bp35/CD20/LEU-16/MGC3969/MS4A2/S7
• Gene Symbols: MS4A1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids 149-184 of human MS4A1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 931
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG