Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MS4A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | MS4A3 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MS4A3 Polyclonal specifically detects MS4A3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MS4A3 | |
Polyclonal | |
Rabbit | |
Human | |
CD20 antigen homolog, CD20 antigen-like protein, CD20LIgE receptor beta subunit, hematopoietic cell 4 transmembrane protein, Hematopoietic-specific transmembrane protein 4, HTm4, HTM4IgE receptor beta chain, membrane-spanning 4-domains subfamily A member 3, membrane-spanning 4-domains, subfamily A, member 3 (hematopoieticcell-specific) | |
MS4A3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
932 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title