Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MS4A4A Antibody, Novus Biologicals™

MS4A4A Antibody, Novus Biologicals™
SDP

Catalog No. p-7108431 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160006 100 μL
NBP16000620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP160006 Supplier Novus Biologicals Supplier No. NBP160006
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MS4A4A Polyclonal specifically detects MS4A4A in Human samples. It is validated for Western Blot.

Specifications

Antigen MS4A4A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96JQ5
Gene Alias 4SPAN1, CD20 antigen-like 1, CD20L1CD20-L1, Fc epsilon receptor beta subunit homolog, Four-span transmembrane protein 1, membrane-spanning 4-domains subfamily A member 4A, membrane-spanning 4-domains, subfamily A, member 4, membrane-spanning 4-domains, subfamily A, member 4A, MS4A4MGC22311, MS4A7
Gene Symbols MS4A4A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MS4A4A(membrane-spanning 4-domains, subfamily A, member 4) The peptide sequence was selected from the N terminal of MS4A4A. Peptide sequence MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL.
Molecular Weight of Antigen 26 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51338
Test Specificity Rat 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.