Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSH5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | MSH5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MSH5 Polyclonal specifically detects MSH5 in Human samples. It is validated for Western Blot.Specifications
| MSH5 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Mismatch Repair | |
| Q9UMP2 | |
| 4439 | |
| Synthetic peptides corresponding to MSH5(mutS homolog 5 (E. coli)) The peptide sequence was selected from the N terminal of MSH5. Peptide sequence KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| DKFZp434C1615, G7, hMSH5, MGC2939, mutS (E. coli) homolog 5, mutS homolog 5 (E. coli), mutS protein homolog 5, MUTSH5, NG23 | |
| MSH5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title