Invitrogen™ MSI1 Monoclonal Antibody (2B9)

Catalog No.	Quantity
PIMA549284	100 μg

Catalog No. PIMA549284 Supplier Invitrogen™ Supplier No. MA549284

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human A549 tissue, human PC-3 whole cell. IHC: human lung cancer tissue, human rectum cancer tissue. ICC/IF: MCF7 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Musashi-1 belongs to the Musashi family of RNA-binding proteins which play a role in cell fate determination, and maintenance of stem-cell state. Musashi family proteins are also involved in post transcriptional gene regulation. The gene encodes a protein with two conserved tandem RNA recognition motifs with highly conserved RNP (ribonucleoprotein) motifs. In mammals, Musashi-1 is expressed in fetal kidney, brain, liver and lung, and in adult brain and pancreas. In humans, the gene is located on chromosome 12.

Specifications

• Antigen: MSI1
• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Classification: Monoclonal
• Clone: 2B9
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: MSI1
• Gene Accession No.: O43347, Q61474, Q8K3P4
• Gene Alias: fb40b12; hypothetical protein LOC541389; m-Msi-1; ms1; msi1; msi1b; Msi1h; Musahi1; musashi homolog 1; Musashi homolog 1(Drosophila); musashi RNA binding protein 1; musashi RNA binding protein 1b; musashi RNA-binding protein 1; musashi1; musashi-1; RNA-binding protein Musashi homolog 1; RNA-binding protein Musashi homolog 1 L+35bp; RNA-binding protein Musashi homolog 1 Long; RNA-binding protein Musashi homolog 1b; wu:fb40b12; zgc:103751; zMsi1
• Gene Symbols: MSI1
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 17690, 259272, 4440
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG2b