Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MSL3L1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310990100UL
Description
MSL3L1 Polyclonal specifically detects MSL3L1 in Mouse samples. It is validated for Western Blot.Specifications
MSL3L1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
male-specific lethal 3 homolog, male-specific lethal 3 homolog (Drosophila), male-specific lethal 3-like 1 (Drosophila), male-specific lethal-3 (Drosophila)-like 1, Male-specific lethal-3 homolog 1, Male-specific lethal-3 protein-like 1, MSL3L1DKFZp586J1822, MSL3-like 1 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse MSL3L1 (NP_034962.2). Peptide sequence VFAGFEGRRPNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVK | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
10943 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction