MSP/MST1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18533025UL

Catalog No. NB406648

Description

MSP/MST1 Polyclonal specifically detects MSP/MST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MSP/MST1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: D3F15S2, EC 3.4.21, hepatocyte growth factor-like protein homolog, HGFLhepatocyte growth factor-like protein, macrophage stimulating 1 (hepatocyte growth factor-like), Macrophage stimulatory protein, Macrophage-stimulating protein, MSPDNF15S2, NF15S2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MST1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 4485
• Target Species: Human
• Isotype: IgG

For Research Use Only