Invitrogen™ MSP Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595493

Catalog No. PIPA595493

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela cell, human MCF-7 cell, human HepG2 cell, human SK-OV-3 cell, human A549 cell, rat kidney tissue, mouse kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

MSP (or MST1) contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.

Specifications

• Antigen: MSP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MST1
• Gene Alias: D3F15S2; D3F15S2h; D8h3f15s2; D9H3F15S2; DNF15S2; DNF15S2h; E2F transcription factor 2; E2F2; Hepatocyte growth factor-like protein; Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain; hepatocyte growth factor-like protein homolog; Hgfl; macrophage stimulating 1; macrophage stimulating 1 (hepatocyte growth factor-like); macrophage stimulatory protein; Macrophage-stimulating protein; MSP; Mst1; NF15S2; Unknown (protein for MGC:137619)
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 15235, 24566, 4485
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P26927, P26928
• Gene Symbols: MST1
• Immunogen: A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG