Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595493

Invitrogen™ MSP Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595493
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595493 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595493 Supplier Invitrogen™ Supplier No. PA595493
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela cell, human MCF-7 cell, human HepG2 cell, human SK-OV-3 cell, human A549 cell, rat kidney tissue, mouse kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

MSP (or MST1) contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MSP
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene MST1
Gene Accession No. P26927, P26928
Gene Alias D3F15S2; D3F15S2h; D8h3f15s2; D9H3F15S2; DNF15S2; DNF15S2h; E2F transcription factor 2; E2F2; Hepatocyte growth factor-like protein; Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain; hepatocyte growth factor-like protein homolog; Hgfl; macrophage stimulating 1; macrophage stimulating 1 (hepatocyte growth factor-like); macrophage stimulatory protein; Macrophage-stimulating protein; MSP; Mst1; NF15S2; Unknown (protein for MGC:137619)
Gene Symbols MST1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15235, 24566, 4485
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.