Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MTCH1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MTCH1 Polyclonal specifically detects MTCH1 in Rat samples. It is validated for Western Blot.Specifications
MTCH1 | |
Polyclonal | |
Rabbit | |
NP_001094303 | |
23787 | |
Synthetic peptide directed towards the middle region of human Mtch1The immunogen for this antibody is Mtch1. Peptide sequence MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cell proliferation-inducing protein 60, CGI-64, MGC131998, mitochondrial carrier homolog 1, mitochondrial carrier homolog 1 (C. elegans), Presenilin-associated protein, PSAPPIG60 | |
MTCH1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title