MTCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169285

Catalog No. NBP169285

Description

MTCH1 Polyclonal specifically detects MTCH1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MTCH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cell proliferation-inducing protein 60, CGI-64, MGC131998, mitochondrial carrier homolog 1, mitochondrial carrier homolog 1 (C. elegans), Presenilin-associated protein, PSAPPIG60
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, Lipid and Metabolism
• Gene ID (Entrez): 23787
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NZJ7-2
• Gene Symbols: MTCH1
• Immunogen: Synthetic peptides corresponding to MTCH1(mitochondrial carrier homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of MTCH1. Peptide sequence NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only