Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	MTMR12
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155211 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155211	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

MTMR12 Polyclonal specifically detects MTMR12 in Human samples. It is validated for Western Blot.

Specifications

Antigen	MTMR12
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Phosphatase
Gene Alias	3-PAP3PAP, 3-phosphatase adapter subunit, KIAA1682FLJ20476, myotubularin related protein 12, myotubularin-related protein 12,3-phosphatase adapter protein, Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit, phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit, phosphatidylinositol-3-phosphate associated protein, PIP3AP
Gene Symbols	MTMR12
Isotype	IgG
Molecular Weight of Antigen	86 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9C0I1
Gene ID (Entrez)	54545
Immunogen	Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MTMR12 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents