MTRR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15774920UL

Catalog No. NBP15774920

Description

MTRR Polyclonal specifically detects MTRR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MTRR
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry
• Gene Accession No.: Q9UBK8
• Gene Symbols: MTRR
• Immunogen: Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing), 5-methyltetrahydrofolate-homocysteine methyltransferase reductase, cblE, EC 1.16.1.8, methionine synthase reductase, methionine synthase reductase, mitochondrial, MGC129643, MSR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4552
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.