Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ MTSS1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP258013PEP

Catalog No. NBP258013PE

Add to cart



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTSS1. Source: E.coli Amino Acid Sequence: DAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMF The MTSS1 Recombinant Protein Antigen is derived from E. coli. The MTSS1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.


Blocking/Neutralizing, Control
>80% by SDS-PAGE and Coomassie blue staining
PBS and 1M Urea, pH 7.4
MTSS1 Recombinant Protein Antigen
Store at −20°C. Avoid freeze-thaw cycles
FLJ44694, KIAA0429Missing in metastasis protein, metastasis suppressor 1, metastasis suppressor protein 1, Metastasis suppressor YGL-1, MIMA, MIMB, MIMDKFZp781P2223, MTSS1
Recombinant Protein Antigen
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.