MTTP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162489

Catalog No. NBP162489

Description

MTTP Polyclonal specifically detects MTTP in Human, Mouse, Drosophila samples. It is validated for Western Blot.

Specifications

• Antigen: MTTP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: 88kD), 88kDa), ABL, MGC149819, microsomal triglyceride transfer protein, microsomal triglyceride transfer protein large subunit, MTPMGC149820
• Host Species: Rabbit
• Molecular Weight of Antigen: 97 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P55157
• Gene Symbols: MTTP
• Immunogen: Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4547
• Target Species: Human, Mouse, Drosophila, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only