MUC1 Antibody, Alexa Fluor™ 405, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160046AF405

Catalog No. NP16046A405

Description

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MUC1
• Classification: Polyclonal
• Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Alias: Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Research Discipline: Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
• Gene ID (Entrez): 4582.0
• Content And Storage: Store at 4°C in the dark.

• Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Alexa Fluor 405
• Formulation: 50 mM sodium borate with 0.05% sodium azide
• Gene Symbols: MUC1
• Immunogen: Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG