Invitrogen™ MUC2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579702

Catalog No. PIPA579702

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: human colon cancer tissue, mouse colon tissue, rat colon tissue.

Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity. Mucin 2 is the major intestinal mucin. O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogeneous and exogeneous lectins.

Specifications

• Antigen: MUC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MUC2
• Gene Alias: 2010015E03Rik; colonic mucin; HH-Muc; intestinal mucin-2; MCM; MLP; muc2; MUC-2; mucin 2; mucin 2, intestinal/tracheal; mucin 2, oligomeric mucus/gel-forming; mucin-2; mucin-like protein; secreted gel-forming mucin; SMUC; wnn
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17831, 24572, 4583
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin)
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: Q02817, Q62635, Q80Z19
• Gene Symbols: MUC2
• Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG