Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MUC3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MUC3B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MUC3B Polyclonal specifically detects MUC3B in Human samples. It is validated for Western Blot.Specifications
MUC3B | |
Polyclonal | |
Rabbit | |
intestinal mucin MUC3B, intestinal mucin-3B, MUC3, MUC-3B, mucin 3B, cell surface associated, mucin-3B | |
MUC3B | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
57876 | |
Synthetic peptide directed towards the middle region of human MUC3BThe immunogen for this antibody is MUC3B. Peptide sequence KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title