Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mucolipin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP192152
Description
Mucolipin 1 Polyclonal specifically detects Mucolipin 1 in Human samples. It is validated for Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
Mucolipin 1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Flow Cytometry -Reported in scientific literature (PMID:31950548)., Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Knockdown Validated - Reported in scientific literature ( (PMID: 31950548) | |
MG-2, ML4TRP-ML1, MLIV, MST080, MSTP080, mucolipidin, mucolipidosis type IV protein, mucolipin 1, mucolipin-1, TRPML1, TRP-ML1, TRPM-L1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MCOLN1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE | |
0.1 mL | |
Cell Biology, Neuroscience, Sensory Systems, Signal Transduction, Vision | |
57192 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction