MUDENG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23381525UL

Catalog No. NB436743

Description

MUDENG Polyclonal specifically detects MUDENG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MUDENG
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9H0R1
• Gene Symbols: AP5M1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55745
• Target Species: Human
• Isotype: IgG

For Research Use Only