Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MuRF1/TRIM63 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154939
Description
MuRF1/TRIM63 Polyclonal specifically detects MuRF1/TRIM63 in Human samples. It is validated for Western Blot.Specifications
| MuRF1/TRIM63 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 6.3.2.-, IRFMURF2, Iris RING finger protein, MuRF1, MuRF-1, muscle specific ring finger protein 2, Muscle-specific RING finger protein 1, RING finger protein 28FLJ32380, RNF28E3 ubiquitin-protein ligase TRIM63, SMRZMURF-1, Striated muscle RING zinc finger protein, tripartite motif containing 63, tripartite motif-containing 63, Tripartite motif-containing protein 63 | |
| Rabbit | |
| 40 kDa | |
| 100 μL | |
| Zinc Finger | |
| 84676 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q969Q1 | |
| TRIM63 | |
| Synthetic peptides corresponding to TRIM63(tripartite motif-containing 63) The peptide sequence was selected from the middle region of TRIM63. Peptide sequence EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction