Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MURF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MURF2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MURF2 Polyclonal specifically detects MURF2 in Human samples. It is validated for Western Blot.Specifications
MURF2 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
MuRF2, MURF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55 | |
TRIM55 | |
IgG | |
27 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9BYV6 | |
84675 | |
Synthetic peptide directed towards the middle region of human TRIM55 (NP_908975). Peptide sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title