Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
Supplier: Novus Biologicals NBP18746625UL
Description
Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Free-Floating.Specifications
Muscarinic Acetylcholine Receptor M1/CHRM1 | |
Polyclonal | |
Western Blot Reported in scientific literature (PMID: 24658304)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Validated from a verified customer review., Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24658304)., Immunohistochemistry Free-Floating Reported in scientific literature (PMID: 31785263). | |
cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human Muscarinic Acetylcholine Receptor M1/CHRM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CHRM1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE | |
25 μL | |
Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators | |
1128 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction