Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Muscleblind-like 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25516525UL
Description
Muscleblind-like 1 Polyclonal specifically detects Muscleblind-like 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Muscleblind-like 1 | |
Polyclonal | |
Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MBNL1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA | |
25 μL | |
Chromatin Research, DNA replication Transcription Translation and Splicing | |
4154 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction