Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
mut-7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | mut-7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
mut-7 Polyclonal specifically detects mut-7 in Human samples. It is validated for Western Blot.Specifications
| mut-7 | |
| Polyclonal | |
| Rabbit | |
| EC 3.1, exonuclease 3'-5' domain containing 3, Exonuclease 3'-5' domain-containing protein 3, FLJ20433, FLJ30442, LOC54932, MGC131904, MGC74981, mut-7, probable exonuclease mut-7 homolog | |
| EXD3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 54932 | |
| Synthetic peptides corresponding to FLJ20433(hypothetical protein FLJ20433) The peptide sequence was selected from the N terminal of FLJ20433. Peptide sequence MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title