Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MVD Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579709
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579709 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579709 Supplier Invitrogen™ Supplier No. PA579709
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 cell, rat liver tissue.

The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MVD
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Mvd
Gene Accession No. P53602, Q62967, Q99JF5
Gene Alias C78718; diphosphomevalonate decarboxylase; FP17780; MDDase; mevalonate (diphospho) decarboxylase; Mevalonate (diphospho)decarboxylase; mevalonate diphosphate decarboxylase; mevalonate pyrophosphate decarboxylase; Mpd; MVD; Mvpd; POROK7
Gene Symbols Mvd
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human MVD (KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 192156, 4597, 81726
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.