Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MxA/Mx1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | MxA/Mx1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MxA/Mx1 Polyclonal specifically detects MxA/Mx1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MxA/Mx1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4599 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| human interferon-regulated resistance GTP-binding protein MXA10IFI-78Khomolog of murine (interferon-inducibleprotein p78), myxovirus (influenza virus) resistance 1, interferon-inducible protein p78(mouse) | |
| MX1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title