Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mxi1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32125825UL
Description
Mxi1 Polyclonal antibody specifically detects Mxi1 in Human samples. It is validated for ImmunofluorescenceSpecifications
Mxi1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
BHLHC11, Class C basic helix-loop-helix protein 11, MAX dimerization protein 2, MAX interacting protein 1, MAX interactor 1bHLHc11MAD2, max-interacting protein 1, Max-related transcription factor, MGC43220, MXD2, MXI | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGP | |
25 μg | |
Cell Cycle and Replication | |
4601 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction