Myelin Protein Zero Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26887825UL

Catalog No. NB392850

Description

Myelin Protein Zero Polyclonal antibody specifically detects Myelin Protein Zero in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Myelin Protein Zero
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
• Quantity: 25 μL
• Research Discipline: Neuronal Cell Markers, Oligodendrocyte Cell Markers
• Gene ID (Entrez): 4359
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified