Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Myeloperoxidase/MPO Antibody, Novus Biologicals™

Myeloperoxidase/MPO Antibody, Novus Biologicals™
SDP

Catalog No. p-200074647 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396611 25 μL
NBP238922 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396611 Supplier Novus Biologicals Supplier No. NBP23892225UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Myeloperoxidase/MPO Polyclonal specifically detects Myeloperoxidase/MPO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Myeloperoxidase/MPO
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P05164
Gene Alias EC 1.11.1, EC 1.11.1.7, myeloperoxidase
Gene Symbols MPO
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology, Immunology, Innate Immunity, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 4353
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.