Learn More
Description
Specifications
Specifications
| Antigen | MYL6 |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | ESMLC, LC17, LC17A, LC17B, LC17-GI, LC17-NM, MLC1SM, MLC-3, MLC3NM, MLC3SM, Myosin light chain 3, Myosin light chain A3, Myosin light chain alkali 3, myosin light polypeptide 6,17 kDa myosin light chain, myosin, light chain 6, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6, alkali, smooth muscle and non-muscle, Smooth muscle and nonmuscle myosin light chain alkali 6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MYL6 (NP_524147). Peptide sequence PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
