Myocilin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP189769

Catalog No. NBP189769

Description

Myocilin Polyclonal specifically detects Myocilin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Myocilin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: GLC1Amyocilin, GPOA, JOAG, JOAG1, myocilin, trabecular meshwork inducible glucocorticoid response, TIGRmutated trabecular meshwork-induced glucocorticoid response protein, Trabecular meshwork-induced glucocorticoid response protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MYOC
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL
• Quantity: 0.1 mL
• Research Discipline: Vision
• Gene ID (Entrez): 4653
• Target Species: Human
• Isotype: IgG

For Research Use Only