Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Myosin Light Chain 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP185541
Description
Myosin Light Chain 2 Polyclonal specifically detects Myosin Light Chain 2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
Myosin Light Chain 2 | |
Polyclonal | |
Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen | |
cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
4633 | |
Human, Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
MYL2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction