Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Myozenin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Myozenin 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Myozenin 1 Polyclonal specifically detects Myozenin 1 in Human samples. It is validated for Western Blot.Specifications
Myozenin 1 | |
Polyclonal | |
Rabbit | |
Q9NP98 | |
58529 | |
Synthetic peptides corresponding to MYOZ1(myozenin 1) The peptide sequence was selected from the middle region of MYOZ1 (NP_067068). Peptide sequence TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
calsarcin-2, CS-2, FATZ, Filamin-, actinin- and telethonin-binding protein, MYOZ, myozenin, myozenin 1, myozenin-1, Protein FATZ | |
MYOZ1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title