Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MYST3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25774525UL
Description
MYST3 Polyclonal specifically detects MYST3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MYST3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transcription factor-binding protein 2, RUNXBP2, Zinc finger protein 220, ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
KAT6A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDSHTKE | |
25 μL | |
Epigenetics | |
7994 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction