N acetyl transferase 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25663525UL

Catalog No. NB394384

Description

N acetyl transferase 5 Polyclonal specifically detects N acetyl transferase 5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: N acetyl transferase 5
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: dJ1002M8.1, dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit), EC 2.3.1.88, homolog), N(alpha)-acetyltransferase 20, NatB catalytic subunit, N-acetyltransferase 3 homolog, N-acetyltransferase 5, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, N-alpha-acetyltransferase 20, NatB catalytic subunit, NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5, NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit), NatB complex subunit NAT5, N-terminal acetyltransferase B complex catalytic subunit NAA20, N-terminal acetyltransferase complex ARD1 subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51126
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NAA20
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only