Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26260725UL
Description
N-Acetylgalactosamine-6-Sulfatase/GALNS Polyclonal antibody specifically detects N-Acetylgalactosamine-6-Sulfatase/GALNS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
N-Acetylgalactosamine-6-Sulfatase/GALNS | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
chondroitinase, chondroitinsulfatase, EC 3.1.6, EC 3.1.6.4, FLJ17434, FLJ42844, FLJ98217, galactosamine (N-acetyl)-6-sulfate sulfatase, Galactose-6-sulfate sulfatase, GALNAC6S, GalNAc6S sulfatase, GAS, MPS4A, N-acetylgalactosamine-6-sulfatase, N-acetylgalactosamine-6-sulfate sulfatase | |
This antibody was developed against a recombinant protein corresponding to amino acids: TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK | |
25 μL | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
2588 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction