N-WASP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Catalog Number	Mfr. No.	Quantity
NBP182512	Novus Biologicals NBP182512	0.1 mL

Description

N-WASP Polyclonal specifically detects N-WASP in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: N-WASP
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8976
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, KnockDown Validated
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: N-WASPneural WiskNWASP, WiskDKFZp779G0847, WiskMGC48327
• Gene Symbols: WASL
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human N-WASP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only