Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAA11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$377.03 - $666.47
Specifications
| Antigen | NAA11 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NAA11 Polyclonal specifically detects NAA11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NAA11 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84779 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ARD1 homolog B, ARD1B, ARD2, hARD2, human arrest defective 2, MGC10646, N(alpha)-acetyltransferase 11, NatA catalytic subunit, NatA catalytic subunit, N-terminal acetyltransferase complex ARD1 subunit homolog B | |
| NAA11 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title