Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAALADase-2/NAALAD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP231840
Description
NAALADase-2/NAALAD2 Polyclonal specifically detects NAALADase-2/NAALAD2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NAALADase-2/NAALAD2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q9Y3Q0 | |
NAALAD2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GCPIII, glutamate carboxypeptidase III, GPCIII, MGC116996, MGC26353, NAADALASE2, NAALADase II, N-acetylated alpha-linked acidic dipeptidase 2, N-acetylated alpha-linked acidic dipeptidase II, N-acetylated-alpha-linked acidic dipeptidase 2, N-acetylated-alpha-linked acidic dipeptidase II | |
Rabbit | |
Affinity Purified | |
RUO | |
10003 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction