Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NALP12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP185555
Description
NALP12 Polyclonal specifically detects NALP12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NALP12 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
FCAS2, Monarch-1, NACHT, leucine rich repeat and PYD containing 12, NACHT, LRR and PYD domains-containing protein 12, NALP12LRR and PYD containing protein 12, NLR family, pyrin domain containing 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12, PYPAF7Monarch1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide, RNO2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
NLRP12 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS | |
0.1 mL | |
Apoptosis | |
91662 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction