Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Nanog Antibody, Novus Biologicals™

Nanog Antibody, Novus Biologicals™
SDP

Catalog No. NB236699 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB236699 25 μg
NB238627 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB236699 Supplier Novus Biologicals Supplier No. NBP32135325UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Nanog Polyclonal antibody specifically detects Nanog in Human samples. It is validated for Immunofluorescence

Specifications

Antigen Nanog
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias FLJ12581, FLJ40451, hNanog, homeobox protein NANOG, Homeobox transcription factor Nanog, homeobox transcription factor Nanog-delta 48, Nanog homeobox
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Apoptosis, Autophagy, Cancer, Cellular Markers, Macroautophagy, mTOR Pathway, Neurodegeneration, Protein Turnover, Regulatory Immunology, Signal Transduction, Stem Cell Markers, Stem Cell Signaling Pathway, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 79923
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.