Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nanog Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32135325UL
Description
Nanog Polyclonal antibody specifically detects Nanog in Human samples. It is validated for ImmunofluorescenceSpecifications
Nanog | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
FLJ12581, FLJ40451, hNanog, homeobox protein NANOG, Homeobox transcription factor Nanog, homeobox transcription factor Nanog-delta 48, Nanog homeobox | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD | |
25 μg | |
Apoptosis, Autophagy, Cancer, Cellular Markers, Macroautophagy, mTOR Pathway, Neurodegeneration, Protein Turnover, Regulatory Immunology, Signal Transduction, Stem Cell Markers, Stem Cell Signaling Pathway, Ubiquitin Proteasome Pathway | |
79923 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction