Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAP1L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | NAP1L1 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NAP1L1 Polyclonal specifically detects NAP1L1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NAP1L1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Mouse, Human, Rat | |
P55209 | |
4673 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
45 kDa |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
hNRP, HSP22-like protein interacting protein, MGC23410, MGC8688, NAP1, NAP-1 related protein, NAP1LFLJ16112, NRPNAP-1-related protein, nucleosome assembly protein 1-like 1 | |
NAP1L1 | |
IgG | |
Affinity Purified | |
Specificity of human NAP1L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title